PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG446200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 242aa    MW: 26337.2 Da    PI: 4.7662
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG446200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-193387256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Pavir.2NG446200.1.p 33 KNKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 87
                         67789*************************************************9 PP

2HD-ZIP_I/II121.83.4e-3934125293
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal  + e+L+ke+++L ++l
  Pavir.2NG446200.1.p  34 NKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKHALLKQL 123
                          79*************************************************************************************999 PP

          HD-ZIP_I/II  92 ke 93 
                          ++
  Pavir.2NG446200.1.p 124 EK 125
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-201890IPR009057Homeodomain-like
SuperFamilySSF466893.64E-192291IPR009057Homeodomain-like
PROSITE profilePS5007117.2652989IPR001356Homeobox domain
SMARTSM003891.9E-163293IPR001356Homeobox domain
CDDcd000862.25E-163390No hitNo description
PfamPF000465.2E-173387IPR001356Homeobox domain
PRINTSPR000317.9E-66069IPR000047Helix-turn-helix motif
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PRINTSPR000317.9E-66985IPR000047Helix-turn-helix motif
PfamPF021836.5E-1389131IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGEDDVPEW MMEVGGGGGK GKGGGGGGGG LDKNKKRFSE EQIKSLESMF ATQTKLEPRQ  60
KLQLARELGL QPRQVAIWFQ NKRARWKSKQ LEREYSALRD DYDALLCSYE SLKKEKHALL  120
KQLEKLAEML QEPRGEYGGN AGAGAGEDVR PGVGGMKEEF ADAGAGLYSS EAADGGKFAH  180
FADDDAGALF RPSPQQPAAG FTTSGPPDHQ PFQFQSSCWP SSTTEQTCSS SQWWEFESLS  240
E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11725GGKGKGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.17130.0callus| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872580.0BT087258.1 Zea mays full-length cDNA clone ZM_BFb0020F23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957433.11e-150PREDICTED: homeobox-leucine zipper protein HOX6-like
SwissprotQ651Z53e-94HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH353e-94HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLK3ZWK11e-150K3ZWK1_SETIT; Uncharacterized protein
STRINGSi030983m1e-149(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-43homeobox 7